SCOPe 2.08: Domain d2i52b2: 2i52 B:2-120

Lineage for d2i52b2 (2i52 B:2-120)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.316: MK0786-like [143559] (1 superfamily)
   alpha(2)-beta(4); 2 layers: a/b; antiparallel beta-sheet, order 1234 (meander)

4. Superfamily d.316.1: MK0786-like [143560] (2 families)
   probable biological unit is a teramer; all subunit interfaces are provided by helices

5. Family d.316.1.1: MK0786-like [143561] (2 proteins)
   single domain; the N-terminal half is covered by Pfam PF04036 (DUF372) and the C-terminal half by Pfam PF04038 (DUF381)

6. Protein Hypothetical protein PTO0218 [143562] (1 species)

7. Species Picrophilus torridus [TaxId:82076] [143563] (1 PDB entry)
   Uniprot Q6L2J9 1-120

8. Domain d2i52b2: 2i52 B:2-120 [137056]
   Other proteins in same PDB: d2i52a2, d2i52b3, d2i52c3, d2i52d3, d2i52e3, d2i52f3
   automated match to d2i52a1
   complexed with ca, cl, gol

Details for d2i52b2

PDB Entry: 2i52, 2.08 Å

PDB Description: crystal structure of protein pto0218 from picrophilus torridus, pfam duf372

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2i52b2:

Sequence, based on SEQRES records:

>d2i52b2 d.316.1.1 (B:2-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
ydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfven
vrisinnvkrssgtysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl

Sequence, based on observed residues (ATOM records):

>d2i52b2 d.316.1.1 (B:2-120) Hypothetical protein PTO0218 {Picrophilus torridus [TaxId: 82076]}
ydpaekyfnctdiqraffeagiklgaifhqytgipvnsenasmaeefierstmiqpfven
vrisinnvkysysslnekmlhaevlinyngkkvlgvlnydegldypvmyakevl

Timeline for d2i52b2:

• d2i52b2 first appeared in SCOP 1.73, called d2i52b1
  
• d2i52b2 appears in SCOPe 2.07