SCOP 1.73: Domain d2i4pb1: 2i4p B:207-476

Lineage for d2i4pb1 (2i4p B:207-476)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)

6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48525] (25 PDB entries)

8. Domain d2i4pb1: 2i4p B:207-476 [137052]
   automatically matched to d1wm0x_
   complexed with drh

Details for d2i4pb1

PDB Entry: 2i4p, 2.1 Å

PDB Description: crystal structure of the complex between ppargamma and the partial agonist lt127 (ureidofibrate derivative). structure obtained from crystals of the apo-form soaked for 30 days.

PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOP Domain Sequences for d2i4pb1:

Sequence; same for both SEQRES and ATOM records:

>d2i4pb1 a.123.1.1 (B:207-476) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

Timeline for d2i4pb1:

• d2i4pb1 is new in SCOP 1.73
  
• d2i4pb1 appears in SCOP 1.75
  
• d2i4pb1 appears in the current release, SCOPe 2.08, called d2i4pb_