Lineage for d2i4pa1 (2i4p A:207-476)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 648095Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 648096Species Human (Homo sapiens) [TaxId:9606] [48525] (25 PDB entries)
  8. 648115Domain d2i4pa1: 2i4p A:207-476 [137051]
    automatically matched to d1wm0x_
    complexed with drh

Details for d2i4pa1

PDB Entry: 2i4p (more details), 2.1 Å

PDB Description: crystal structure of the complex between ppargamma and the partial agonist lt127 (ureidofibrate derivative). structure obtained from crystals of the apo-form soaked for 30 days.
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOP Domain Sequences for d2i4pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i4pa1 a.123.1.1 (A:207-476) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

SCOP Domain Coordinates for d2i4pa1:

Click to download the PDB-style file with coordinates for d2i4pa1.
(The format of our PDB-style files is described here.)

Timeline for d2i4pa1: