![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins) |
![]() | Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48525] (46 PDB entries) Uniprot P37231 232-505 |
![]() | Domain d2i4jb1: 2i4j B:207-476 [137050] automatically matched to d1wm0x_ complexed with drj |
PDB Entry: 2i4j (more details), 2.1 Å
SCOP Domain Sequences for d2i4jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i4jb1 a.123.1.1 (B:207-476) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv tehvqllqvikktetdmslhpllqeiykdl
Timeline for d2i4jb1: