SCOPe 2.08: Domain d2i4jb_: 2i4j B:

Lineage for d2i4jb_ (2i4j B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48525] (172 PDB entries)
   Uniprot P37231 232-505

8. Domain d2i4jb_: 2i4j B: [137050]
   automated match to d1nyxa_
   complexed with drj

Details for d2i4jb_

PDB Entry: 2i4j, 2.1 Å

PDB Description: crystal structure of the complex between ppargamma and the agonist lt160 (ureidofibrate derivative)

PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d2i4jb_:

Sequence; same for both SEQRES and ATOM records:

>d2i4jb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

Timeline for d2i4jb_:

• d2i4jb_ first appeared in SCOP 1.73, called d2i4jb1
  
• d2i4jb_ appears in SCOPe 2.07