SCOP 1.73: Domain d2i47d1: 2i47 D:220-473

Lineage for d2i47d1 (2i47 D:220-473)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (1 protein)

6. Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55527] (4 PDB entries)

8. Domain d2i47d1: 2i47 D:220-473 [137048]
   automatically matched to d1bkca_
   complexed with inn, kgy, zn; mutant

Details for d2i47d1

PDB Entry: 2i47, 1.9 Å

PDB Description: crystal structure of catalytic domain of tace with inhibitor

PDB Compounds: (D:) adam 17

SCOP Domain Sequences for d2i47d1:

Sequence; same for both SEQRES and ATOM records:

>d2i47d1 d.92.1.10 (D:220-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
pmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqi
eqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlft
yqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkea
dlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsiy
ktieskaqecfqer

Timeline for d2i47d1:

• d2i47d1 is new in SCOP 1.73
  
• d2i47d1 appears in SCOP 1.75
  
• d2i47d1 appears in the current release, SCOPe 2.08, called d2i47d_