SCOPe 2.08: Domain d2i47d_: 2i47 D:

Lineage for d2i47d_ (2i47 D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
   automatically mapped to Pfam PF13574
   automatically mapped to Pfam PF13583

6. Protein automated matches [190185] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186923] (2 PDB entries)

8. Domain d2i47d_: 2i47 D: [137048]
   automated match to d3leab_
   complexed with inn, kgy, zn

Details for d2i47d_

PDB Entry: 2i47, 1.9 Å

PDB Description: crystal structure of catalytic domain of tace with inhibitor

PDB Compounds: (D:) adam 17

SCOPe Domain Sequences for d2i47d_:

Sequence; same for both SEQRES and ATOM records:

>d2i47d_ d.92.1.10 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqi
eqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlft
yqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkea
dlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsiy
ktieskaqecfqers

Timeline for d2i47d_:

• d2i47d_ first appeared in SCOP 1.73, called d2i47d1
  
• d2i47d_ appears in SCOPe 2.07