Lineage for d2i47c_ (2i47 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917879Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
    automatically mapped to Pfam PF13574
    automatically mapped to Pfam PF13583
  6. 1917924Protein automated matches [190185] (1 species)
    not a true protein
  7. 1917925Species Human (Homo sapiens) [TaxId:9606] [186923] (2 PDB entries)
  8. 1917928Domain d2i47c_: 2i47 C: [137047]
    automated match to d3leab_
    complexed with inn, kgy, zn

Details for d2i47c_

PDB Entry: 2i47 (more details), 1.9 Å

PDB Description: crystal structure of catalytic domain of tace with inhibitor
PDB Compounds: (C:) adam 17

SCOPe Domain Sequences for d2i47c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i47c_ d.92.1.10 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqie
qirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlfty
qdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkead
lvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsiyk
tieskaqecfqers

SCOPe Domain Coordinates for d2i47c_:

Click to download the PDB-style file with coordinates for d2i47c_.
(The format of our PDB-style files is described here.)

Timeline for d2i47c_: