| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins) automatically mapped to Pfam PF13574 automatically mapped to Pfam PF13583 |
| Protein automated matches [190185] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186923] (2 PDB entries) |
| Domain d2i47b_: 2i47 B: [137046] automated match to d3leab_ complexed with inn, kgy, zn |
PDB Entry: 2i47 (more details), 1.9 Å
SCOPe Domain Sequences for d2i47b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i47b_ d.92.1.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqie
qirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlfty
qdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkead
lvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsiyk
tieskaqecfqers
Timeline for d2i47b_: