Lineage for d2i47b1 (2i47 B:221-473)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867857Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (1 protein)
  6. 867858Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)
  7. 867859Species Human (Homo sapiens) [TaxId:9606] [55527] (7 PDB entries)
  8. 867861Domain d2i47b1: 2i47 B:221-473 [137046]
    automatically matched to d1bkca_
    complexed with inn, kgy, zn; mutant

Details for d2i47b1

PDB Entry: 2i47 (more details), 1.9 Å

PDB Description: crystal structure of catalytic domain of tace with inhibitor
PDB Compounds: (B:) adam 17

SCOP Domain Sequences for d2i47b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i47b1 d.92.1.10 (B:221-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
mkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqie
qirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlfty
qdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkead
lvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsiyk
tieskaqecfqer

SCOP Domain Coordinates for d2i47b1:

Click to download the PDB-style file with coordinates for d2i47b1.
(The format of our PDB-style files is described here.)

Timeline for d2i47b1: