Lineage for d2i47a_ (2i47 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964179Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
    automatically mapped to Pfam PF13574
    automatically mapped to Pfam PF13583
  6. 2964224Protein automated matches [190185] (1 species)
    not a true protein
  7. 2964225Species Human (Homo sapiens) [TaxId:9606] [186923] (2 PDB entries)
  8. 2964226Domain d2i47a_: 2i47 A: [137045]
    automated match to d3leab_
    complexed with inn, kgy, zn

Details for d2i47a_

PDB Entry: 2i47 (more details), 1.9 Å

PDB Description: crystal structure of catalytic domain of tace with inhibitor
PDB Compounds: (A:) adam 17

SCOPe Domain Sequences for d2i47a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i47a_ d.92.1.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqi
eqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlft
yqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkea
dlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsiy
ktieskaqecfqers

SCOPe Domain Coordinates for d2i47a_:

Click to download the PDB-style file with coordinates for d2i47a_.
(The format of our PDB-style files is described here.)

Timeline for d2i47a_: