Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins) automatically mapped to Pfam PF13574 automatically mapped to Pfam PF13583 |
Protein automated matches [190185] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186923] (2 PDB entries) |
Domain d2i47a_: 2i47 A: [137045] automated match to d3leab_ complexed with inn, kgy, zn |
PDB Entry: 2i47 (more details), 1.9 Å
SCOPe Domain Sequences for d2i47a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i47a_ d.92.1.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqi eqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlft yqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkea dlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsiy ktieskaqecfqers
Timeline for d2i47a_: