Lineage for d2i3ta1 (2i3t A:1-340)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675262Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 675344Superfamily b.69.4: WD40 repeat-like [50978] (2 families) (S)
    also contains 8-bladed propellers
  5. 675415Family b.69.4.2: Cell cycle arrest protein BUB3 [110289] (1 protein)
    possibly related to the WD-repeat family; both sequence similarity between the blades and the WD40 repeat signature are very weak
    this is a repeat family; one repeat unit is 1u4c A:12-56 found in domain
  6. 675416Protein Cell cycle arrest protein BUB3 [110290] (1 species)
  7. 675417Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110291] (4 PDB entries)
  8. 675424Domain d2i3ta1: 2i3t A:1-340 [137034]
    automatically matched to d1yfqa_

Details for d2i3ta1

PDB Entry: 2i3t (more details), 2.8 Å

PDB Description: Bub3 complex with Mad3 (BubR1) GLEBS motif
PDB Compounds: (A:) Cell cycle arrest protein

SCOP Domain Sequences for d2i3ta1:

Sequence, based on SEQRES records: (download)

>d2i3ta1 b.69.4.2 (A:1-340) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
acsdnilclatsddtfktnaaidqtielnassiyiifdye

Sequence, based on observed residues (ATOM records): (download)

>d2i3ta1 b.69.4.2 (A:1-340) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddsskrfafrchrlnlk
dtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdni
lclatsddtfktnaaidqtielnassiyiifdye

SCOP Domain Coordinates for d2i3ta1:

Click to download the PDB-style file with coordinates for d2i3ta1.
(The format of our PDB-style files is described here.)

Timeline for d2i3ta1: