Lineage for d2i3sc_ (2i3s C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2066095Family b.69.4.2: Cell cycle arrest protein BUB3 [110289] (2 protein domains)
    possibly related to the WD-repeat family; both sequence similarity between the blades and the WD40 repeat signature are very weak
  6. 2066101Protein automated matches [190323] (1 species)
    not a true protein
  7. 2066102Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187140] (2 PDB entries)
  8. 2066104Domain d2i3sc_: 2i3s C: [137032]
    automated match to d1yfqa_

Details for d2i3sc_

PDB Entry: 2i3s (more details), 1.9 Å

PDB Description: Bub3 complex with Bub1 GLEBS motif
PDB Compounds: (C:) Cell cycle arrest protein

SCOPe Domain Sequences for d2i3sc_:

Sequence, based on SEQRES records: (download)

>d2i3sc_ b.69.4.2 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
dglievidprnygdgviavknlnsnntkvknkiftmdtnssrlivgmnnsqvqwfrlplc
eddngtieesglkyqirdvallpkeqegyacssidgrvaveffddqgddynsskrfafrc
hrlnlkdtnlaypvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvki
acsdnilclatsddtfktnaaidqtielnassiyiifdye

Sequence, based on observed residues (ATOM records): (download)

>d2i3sc_ b.69.4.2 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mqivqieqapkdyisdikiipskslllitswdgsltvykfdiqaknvdllqslrykhpll
ccnfidntdlqiyvgtvqgeilkvdligspsfqaltnneanlgicrickygddkliaasw
dglievidprnygdgviavknlnsknkiftmdtnssrlivgmnnsqvqwfrlplceddng
tieesglkyqirdvallpkeqegyacssidgrvaveffddskrfafrchrlnlkdtnlay
pvnsiefsprhkflytagsdgiiscwnlqtrkkiknfakfnedsvvkiacsdnilclats
ddtfktnaaidqtielnassiyiifdye

SCOPe Domain Coordinates for d2i3sc_:

Click to download the PDB-style file with coordinates for d2i3sc_.
(The format of our PDB-style files is described here.)

Timeline for d2i3sc_: