Lineage for d2i3od_ (2i3o D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995850Family d.153.1.6: Gamma-glutamyltranspeptidase-like [143906] (4 proteins)
    Pfam PF01019
  6. 2995872Protein Hypothetical protein Ta0994 [143907] (1 species)
  7. 2995873Species Thermoplasma acidophilum [TaxId:2303] [143908] (1 PDB entry)
    Uniprot Q9HJH4 1-516
  8. 2995877Domain d2i3od_: 2i3o D: [137030]
    automated match to d2i3oa1

Details for d2i3od_

PDB Entry: 2i3o (more details), 2.03 Å

PDB Description: crystal structure of gamma-glutamyl transferase related protein from thermoplasma acidophilum
PDB Compounds: (D:) Gamma-glutamyltransferase related protein

SCOPe Domain Sequences for d2i3od_:

Sequence, based on SEQRES records: (download)

>d2i3od_ d.153.1.6 (D:) Hypothetical protein Ta0994 {Thermoplasma acidophilum [TaxId: 2303]}
mfrsrpnalsqrsviassselaslagrdilkrggnifdaalavsamlcvtqnnlcglggd
lfalirdengqimdlngsgqasravsidyyesmgltkipergpyaaitvpgiagswdeif
rkfatmdiadilepairtasagfpitqnysdsiarsapvigqyrgwssifmpngsvpvag
eilkqpdlaesfrlmseegfrsfydgsladiiiaglegtgsplsdrdlrvyrpligkpvf
tdldefriyetspnsqgitviewirgmeshgydsrtmweakiedifetmeeaydkrrkit
dpsymniaqhdsangkkdglpkrdhndigdttyfsisdsegrsvsiiqsnymgfgsgivp
kgtgfvlqnrgsyftlqrdhpnalmpgkrtfhtlaacmvekehdlyaslgsmggdiqpqv
qmqilmeilkdntdpqaildkprwtepytiyeapgavyveseelyrnvskqisgrkvvlr
dvsqefgtaqittlirgdvvvgaadprgdgiaipys

Sequence, based on observed residues (ATOM records): (download)

>d2i3od_ d.153.1.6 (D:) Hypothetical protein Ta0994 {Thermoplasma acidophilum [TaxId: 2303]}
mfrsrpnalsqrsviassselaslagrdilkrggnifdaalavsamlcvtqnnlcglggd
lfalirdengqimdlngsgqasravsidyyesmgltkipergpyaaitvpgiagswdeif
rkfatmdiadilepairtasagfpitqnysdsiarsapvigqyrgwssifmpngsvpvag
eilkqpdlaesfrlmseegfrsfydgsladiiiaglegtgsplsdrdlrvyrpligkpvf
tdldefriyetspnsqgitviewirgmeshgydsrtmweakiedifetmeeaydkrrkit
dpsymniaqhdsangkglpkrdhndigdttyfsisdsegrsvsiiqsnymgfgsgivpkg
tgfvlqnrgsyftlqrdhpnalmpgkrtfhtlaacmvekehdlyaslgsmggdiqpqvqm
qilmeilkdntdpqaildkprwtepytiyeapgavyveseelyrnvskqisgrkvvlrdv
sqefgtaqittlirgdvvvgaadprgdgiaipys

SCOPe Domain Coordinates for d2i3od_:

Click to download the PDB-style file with coordinates for d2i3od_.
(The format of our PDB-style files is described here.)

Timeline for d2i3od_: