Lineage for d2i3hb1 (2i3h B:78-167)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894130Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 894131Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 894132Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins)
  6. 894190Protein BIR-containing protein 7 (ML-IAP, livin) [103630] (1 species)
  7. 894191Species Human (Homo sapiens) [TaxId:9606] [103631] (6 PDB entries)
    Uniprot Q96CA5 78-159
  8. 894193Domain d2i3hb1: 2i3h B:78-167 [137024]
    automatically matched to d1tw6b_
    complexed with btb, edo, li, zn; mutant

Details for d2i3hb1

PDB Entry: 2i3h (more details), 1.62 Å

PDB Description: structure of an ml-iap/xiap chimera bound to a 4-mer peptide (avpw)
PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 7

SCOP Domain Sequences for d2i3hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i3hb1 g.52.1.1 (B:78-167) BIR-containing protein 7 (ML-IAP, livin) {Human (Homo sapiens) [TaxId: 9606]}
gpafpgmgseelrlasfydwpltaevppellaaagffhtghqdkvrcffcygglqswkrg
ddpwtehakwfpgcqfllrskgqeyinnih

SCOP Domain Coordinates for d2i3hb1:

Click to download the PDB-style file with coordinates for d2i3hb1.
(The format of our PDB-style files is described here.)

Timeline for d2i3hb1: