![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
![]() | Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) ![]() |
![]() | Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
![]() | Protein Ribosomal protein L25 [50717] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [50718] (12 PDB entries) |
![]() | Domain d2i2vv1: 2i2v V:1-94 [137017] Other proteins in same PDB: d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vl1, d2i2vm1, d2i2vp1, d2i2vr1, d2i2vu1, d2i2vy1 automatically matched to d1b75a_ complexed with mg, zn |
PDB Entry: 2i2v (more details), 3.22 Å
SCOP Domain Sequences for d2i2vv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2vv1 b.53.1.1 (V:1-94) Ribosomal protein L25 {Escherichia coli [TaxId: 562]} mftinaevrkeqgkgasrrlraankfpaiiyggkeaplaieldhdkvmnmqakaefysev ltivvdgkeikvkaqdvqrhpykpklqhidfvra
Timeline for d2i2vv1: