![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
![]() | Superfamily b.155.1: L21p-like [141091] (1 family) ![]() |
![]() | Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
![]() | Protein Ribosomal protein L21p [141093] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [141094] (27 PDB entries) Uniprot P0AG48 1-103 |
![]() | Domain d2i2vr1: 2i2v R:1-103 [137015] Other proteins in same PDB: d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vc1, d2i2vc2, d2i2vd1, d2i2ve1, d2i2vf1, d2i2vg1, d2i2vg2, d2i2vh1, d2i2vh2, d2i2vi1, d2i2vi2, d2i2vj1, d2i2vk1, d2i2vl1, d2i2vm1, d2i2vn1, d2i2vo1, d2i2vp1, d2i2vq1, d2i2vs1, d2i2vt1, d2i2vu1, d2i2vv1, d2i2vw1, d2i2vx1, d2i2vy1, d2i2vz1 automatically matched to 2AW4 R:1-103 protein/RNA complex; complexed with mg, zn |
PDB Entry: 2i2v (more details), 3.22 Å
SCOPe Domain Sequences for d2i2vr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2vr1 b.155.1.1 (R:1-103) Ribosomal protein L21p {Escherichia coli [TaxId: 562]} myavfqsggkqhrvsegqtvrlekldiatgetvefaevlmiangeevkigvpfvdggvik aevvahgrgekvkivkfrrrkhyrkqqghrqwftdvkitgisa
Timeline for d2i2vr1:
![]() Domains from other chains: (mouse over for more information) d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vc1, d2i2vc2, d2i2vd1, d2i2ve1, d2i2vf1, d2i2vg1, d2i2vg2, d2i2vh1, d2i2vh2, d2i2vi1, d2i2vi2, d2i2vj1, d2i2vk1, d2i2vl1, d2i2vm1, d2i2vn1, d2i2vo1, d2i2vp1, d2i2vq1, d2i2vs1, d2i2vt1, d2i2vu1, d2i2vv1, d2i2vw1, d2i2vx1, d2i2vy1, d2i2vz1 |