![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein) Pfam PF01245 |
![]() | Protein Ribosomal protein L19 [141246] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141247] (9 PDB entries) |
![]() | Domain d2i2vp1: 2i2v P:1-114 [137014] Other proteins in same PDB: d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vl1, d2i2vm1, d2i2vr1, d2i2vu1, d2i2vv1, d2i2vy1 automatically matched to 2AW4 P:1-114 complexed with mg, zn |
PDB Entry: 2i2v (more details), 3.22 Å
SCOP Domain Sequences for d2i2vp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2vp1 b.34.5.6 (P:1-114) Ribosomal protein L19 {Escherichia coli [TaxId: 562]} sniikqleqeqmkqdvpsfrpgdtvevkvwvvegskkrlqafegvviairnrglhsaftv rkisngegvervfqthspvvdsisvkrrgavrkaklyylrertgkaarikerln
Timeline for d2i2vp1: