Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) |
Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein) Pfam PF00252 |
Protein Ribosomal protein L16p [117889] (4 species) |
Species Escherichia coli [TaxId:562] [143200] (29 PDB entries) Uniprot P0ADY7 1-136 |
Domain d2i2vm1: 2i2v M:1-136 [137013] Other proteins in same PDB: d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vc1, d2i2vc2, d2i2vd1, d2i2ve1, d2i2vf1, d2i2vg1, d2i2vg2, d2i2vh1, d2i2vh2, d2i2vi1, d2i2vi2, d2i2vj1, d2i2vk1, d2i2vl1, d2i2vn1, d2i2vo1, d2i2vp1, d2i2vq1, d2i2vr1, d2i2vs1, d2i2vt1, d2i2vu1, d2i2vv1, d2i2vw1, d2i2vx1, d2i2vy1, d2i2vz1 automatically matched to 2AW4 M:1-136 protein/RNA complex; complexed with mg, zn |
PDB Entry: 2i2v (more details), 3.22 Å
SCOPe Domain Sequences for d2i2vm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2vm1 d.41.4.2 (M:1-136) Ribosomal protein L16p {Escherichia coli [TaxId: 562]} mlqpkrtkfrkmhkgrnrglaqgtdvsfgsfglkavgrgrltarqieaarramtravkrq gkiwirvfpdkpitekplavrmgkgkgnveywvaliqpgkvlyemdgvpeelareafkla aaklpikttfvtktvm
Timeline for d2i2vm1:
View in 3D Domains from other chains: (mouse over for more information) d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vc1, d2i2vc2, d2i2vd1, d2i2ve1, d2i2vf1, d2i2vg1, d2i2vg2, d2i2vh1, d2i2vh2, d2i2vi1, d2i2vi2, d2i2vj1, d2i2vk1, d2i2vl1, d2i2vn1, d2i2vo1, d2i2vp1, d2i2vq1, d2i2vr1, d2i2vs1, d2i2vt1, d2i2vu1, d2i2vv1, d2i2vw1, d2i2vx1, d2i2vy1, d2i2vz1 |