Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Escherichia coli [TaxId:562] [111186] (9 PDB entries) |
Domain d2i2uh1: 2i2u H:3-129 [137006] automatically matched to d1s03h_ complexed with mg |
PDB Entry: 2i2u (more details), 3.22 Å
SCOP Domain Sequences for d2i2uh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2uh1 d.140.1.1 (H:3-129) Ribosomal protein S8 {Escherichia coli [TaxId: 562]} qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg eiicyva
Timeline for d2i2uh1: