Class b: All beta proteins [48724] (174 folds) |
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) |
Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
Protein Ribosomal protein L25 [50717] (1 species) |
Species Escherichia coli [TaxId:562] [50718] (32 PDB entries) |
Domain d2i2tv1: 2i2t V:1-94 [137004] Other proteins in same PDB: d2i2t01, d2i2t11, d2i2t21, d2i2t31, d2i2t41, d2i2tc1, d2i2tc2, d2i2td1, d2i2te1, d2i2tf1, d2i2tg1, d2i2tg2, d2i2th1, d2i2th2, d2i2ti1, d2i2ti2, d2i2tj1, d2i2tk1, d2i2tl1, d2i2tm1, d2i2tn1, d2i2to1, d2i2tp1, d2i2tq1, d2i2tr1, d2i2ts1, d2i2tt1, d2i2tu1, d2i2tw1, d2i2tx1, d2i2ty1, d2i2tz1 automatically matched to d1b75a_ complexed with mg, zn |
PDB Entry: 2i2t (more details), 3.22 Å
SCOP Domain Sequences for d2i2tv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2tv1 b.53.1.1 (V:1-94) Ribosomal protein L25 {Escherichia coli [TaxId: 562]} mftinaevrkeqgkgasrrlraankfpaiiyggkeaplaieldhdkvmnmqakaefysev ltivvdgkeikvkaqdvqrhpykpklqhidfvra
Timeline for d2i2tv1:
View in 3D Domains from other chains: (mouse over for more information) d2i2t01, d2i2t11, d2i2t21, d2i2t31, d2i2t41, d2i2tc1, d2i2tc2, d2i2td1, d2i2te1, d2i2tf1, d2i2tg1, d2i2tg2, d2i2th1, d2i2th2, d2i2ti1, d2i2ti2, d2i2tj1, d2i2tk1, d2i2tl1, d2i2tm1, d2i2tn1, d2i2to1, d2i2tp1, d2i2tq1, d2i2tr1, d2i2ts1, d2i2tt1, d2i2tu1, d2i2tw1, d2i2tx1, d2i2ty1, d2i2tz1 |