![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
![]() | Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
![]() | Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
![]() | Protein Ribosomal protein L15 (L15p) [52082] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [141994] (9 PDB entries) |
![]() | Domain d2i2tl1: 2i2t L:2-144 [136999] Other proteins in same PDB: d2i2t01, d2i2t11, d2i2t21, d2i2t31, d2i2t41, d2i2tm1, d2i2tp1, d2i2tr1, d2i2tu1, d2i2tv1, d2i2ty1 automatically matched to 2AW4 L:1-144 complexed with mg, zn |
PDB Entry: 2i2t (more details), 3.22 Å
SCOP Domain Sequences for d2i2tl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2tl1 c.12.1.1 (L:2-144) Ribosomal protein L15 (L15p) {Escherichia coli [TaxId: 562]} rlntlspaegskkagkrlgrgigsglgktggrghkgqksrsgggvrrgfeggqmplyrrl pkfgftsrkaaitaeirlsdlakveggvvdlntlkaaniigiqiefakvilagevttpvt vrglrvtkgaraaieaaggkiee
Timeline for d2i2tl1: