SCOP 1.73: Domain d2i1lb1: 2i1l B:459-589

Lineage for d2i1lb1 (2i1l B:459-589)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.5: Riboflavin kinase-like [82114] (1 family)

5. Family b.43.5.1: Riboflavin kinase-like [82115] (2 proteins)

6. Protein Riboflavin kinase domain of bifunctional FAD synthetase [101786] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101787] (6 PDB entries)
   TM0379

8. Domain d2i1lb1: 2i1l B:459-589 [136982]
   Other proteins in same PDB: d2i1la2, d2i1lb2
   automatically matched to d1mrzb1

Details for d2i1lb1

PDB Entry: 2i1l, 2.5 Å

PDB Description: Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima

PDB Compounds: (B:) Riboflavin kinase/FMN adenylyltransferase

SCOP Domain Sequences for d2i1lb1:

Sequence, based on SEQRES records:

>d2i1lb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgf
rptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksar
nmiddiinskf

Sequence, based on observed residues (ATOM records):

>d2i1lb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyildf
egdlygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskf

Timeline for d2i1lb1:

• d2i1lb1 is new in SCOP 1.73
  
• d2i1lb1 appears in SCOP 1.75
  
• d2i1lb1 appears in the current release, SCOPe 2.08