Lineage for d2i1la2 (2i1l A:2-158)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468637Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2468652Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species)
  7. 2468653Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries)
    Uniprot Q9WZW1
    TM0379
  8. 2468662Domain d2i1la2: 2i1l A:2-158 [136981]
    Other proteins in same PDB: d2i1la1, d2i1lb1
    automated match to d1mrzb2

Details for d2i1la2

PDB Entry: 2i1l (more details), 2.5 Å

PDB Description: Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima
PDB Compounds: (A:) Riboflavin kinase/FMN adenylyltransferase

SCOPe Domain Sequences for d2i1la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i1la2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
vyeiedvvvqgkrvssslirnlvqegrveeipaylgr

SCOPe Domain Coordinates for d2i1la2:

Click to download the PDB-style file with coordinates for d2i1la2.
(The format of our PDB-style files is described here.)

Timeline for d2i1la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i1la1