Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species) |
Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries) Uniprot Q9WZW1 TM0379 |
Domain d2i1la2: 2i1l A:2-158 [136981] Other proteins in same PDB: d2i1la1, d2i1lb1 automated match to d1mrzb2 |
PDB Entry: 2i1l (more details), 2.5 Å
SCOPe Domain Sequences for d2i1la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i1la2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve vyeiedvvvqgkrvssslirnlvqegrveeipaylgr
Timeline for d2i1la2: