SCOP 1.75: Domain d2i1la2: 2i1l A:2-158

Lineage for d2i1la2 (2i1l A:2-158)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (5 proteins)

6. Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries)
   Uniprot Q9WZW1
   TM0379

8. Domain d2i1la2: 2i1l A:2-158 [136981]
   Other proteins in same PDB: d2i1la1, d2i1lb1
   automatically matched to d1s4ma2

Details for d2i1la2

PDB Entry: 2i1l, 2.5 Å

PDB Description: Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima

PDB Compounds: (A:) Riboflavin kinase/FMN adenylyltransferase

SCOP Domain Sequences for d2i1la2:

Sequence; same for both SEQRES and ATOM records:

>d2i1la2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
vyeiedvvvqgkrvssslirnlvqegrveeipaylgr

Timeline for d2i1la2:

• d2i1la2 first appeared in SCOP 1.73
  
• d2i1la2 appears in SCOPe 2.01
  
• d2i1la2 appears in the current release, SCOPe 2.08