Lineage for d2i1la1 (2i1l A:159-289)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669846Superfamily b.43.5: Riboflavin kinase-like [82114] (1 family) (S)
  5. 669847Family b.43.5.1: Riboflavin kinase-like [82115] (2 proteins)
  6. 669862Protein Riboflavin kinase domain of bifunctional FAD synthetase [101786] (1 species)
  7. 669863Species Thermotoga maritima [TaxId:2336] [101787] (6 PDB entries)
    TM0379
  8. 669872Domain d2i1la1: 2i1l A:159-289 [136980]
    Other proteins in same PDB: d2i1la2, d2i1lb2
    automatically matched to d1mrzb1

Details for d2i1la1

PDB Entry: 2i1l (more details), 2.5 Å

PDB Description: Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima
PDB Compounds: (A:) Riboflavin kinase/FMN adenylyltransferase

SCOP Domain Sequences for d2i1la1:

Sequence, based on SEQRES records: (download)

>d2i1la1 b.43.5.1 (A:159-289) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgf
rptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksar
nmiddiinskf

Sequence, based on observed residues (ATOM records): (download)

>d2i1la1 b.43.5.1 (A:159-289) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrnvkyevyild
fegdlygqrlklevlkfmrdekkeelkaaidqdvksarnmiddiinskf

SCOP Domain Coordinates for d2i1la1:

Click to download the PDB-style file with coordinates for d2i1la1.
(The format of our PDB-style files is described here.)

Timeline for d2i1la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i1la2