Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (2 families) |
Family d.41.2.1: NadC N-terminal domain-like [54676] (4 proteins) |
Protein Nicotinate-nucleotide pyrophosphorylase PF1904 [143195] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [143196] (1 PDB entry) Uniprot Q8TZS9 1-110 |
Domain d2i14f2: 2i14 F:2401-2510 [136977] Other proteins in same PDB: d2i14a1, d2i14b1, d2i14c1, d2i14d1, d2i14e1, d2i14f1 automatically matched to 2I14 A:1-110 complexed with pcp, zn |
PDB Entry: 2i14 (more details), 2.9 Å
SCOPe Domain Sequences for d2i14f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i14f2 d.41.2.1 (F:2401-2510) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} mkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwgvlvgve evakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmls
Timeline for d2i14f2: