Lineage for d2i14f2 (2i14 F:2401-2510)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859091Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 859151Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (2 families) (S)
  5. 859152Family d.41.2.1: NadC N-terminal domain-like [54676] (4 proteins)
  6. 859156Protein Nicotinate-nucleotide pyrophosphorylase PF1904 [143195] (1 species)
  7. 859157Species Pyrococcus furiosus [TaxId:2261] [143196] (1 PDB entry)
    Uniprot Q8TZS9 1-110
  8. 859163Domain d2i14f2: 2i14 F:2401-2510 [136977]
    Other proteins in same PDB: d2i14a1, d2i14b1, d2i14c1, d2i14d1, d2i14e1, d2i14f1
    automatically matched to 2I14 A:1-110
    complexed with pcp, zn

Details for d2i14f2

PDB Entry: 2i14 (more details), 2.9 Å

PDB Description: Crystal structure of nicotinate-nucleotide pyrophosphorylase from Pyrococcus furiosus
PDB Compounds: (F:) Nicotinate-nucleotide pyrophosphorylase

SCOP Domain Sequences for d2i14f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i14f2 d.41.2.1 (F:2401-2510) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]}
mkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwgvlvgve
evakllegipvnvyampegtifhpyepvlqiegdyadfgiyetallgmls

SCOP Domain Coordinates for d2i14f2:

Click to download the PDB-style file with coordinates for d2i14f2.
(The format of our PDB-style files is described here.)

Timeline for d2i14f2: