Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins) |
Protein Nicotinate-nucleotide pyrophosphorylase PF1904 [141857] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [141858] (1 PDB entry) Uniprot Q8TZS9 111-389 |
Domain d2i14f1: 2i14 F:2511-2789 [136976] Other proteins in same PDB: d2i14a2, d2i14b2, d2i14c2, d2i14d2, d2i14e2, d2i14f2 automated match to d2i14a1 complexed with pcp, zn |
PDB Entry: 2i14 (more details), 2.9 Å
SCOPe Domain Sequences for d2i14f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i14f1 c.1.17.1 (F:2511-2789) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} qasgiataalrikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmge kavgtmphaliitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklf avrldtpssrrgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvgg aiasakpvdfaldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnak vepllkpiiengeivvefpkareireyvleqakkfnlei
Timeline for d2i14f1: