![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (2 families) ![]() incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
![]() | Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins) |
![]() | Protein Nicotinate-nucleotide pyrophosphorylase PF1904 [141857] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [141858] (1 PDB entry) |
![]() | Domain d2i14f1: 2i14 F:2511-2789 [136976] Other proteins in same PDB: d2i14a2, d2i14b2, d2i14c2, d2i14d2, d2i14e2, d2i14f2 automatically matched to 2I14 A:111-389 complexed with pcp, zn |
PDB Entry: 2i14 (more details), 2.9 Å
SCOP Domain Sequences for d2i14f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i14f1 c.1.17.1 (F:2511-2789) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} qasgiataalrikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmge kavgtmphaliitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklf avrldtpssrrgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvgg aiasakpvdfaldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnak vepllkpiiengeivvefpkareireyvleqakkfnlei
Timeline for d2i14f1: