Lineage for d2i14c1 (2i14 C:1111-1389)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818923Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (2 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 818924Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins)
  6. 818928Protein Nicotinate-nucleotide pyrophosphorylase PF1904 [141857] (1 species)
  7. 818929Species Pyrococcus furiosus [TaxId:2261] [141858] (1 PDB entry)
    Uniprot Q8TZS9 111-389
  8. 818932Domain d2i14c1: 2i14 C:1111-1389 [136970]
    Other proteins in same PDB: d2i14a2, d2i14b2, d2i14c2, d2i14d2, d2i14e2, d2i14f2
    automatically matched to 2I14 A:111-389
    complexed with pcp, zn

Details for d2i14c1

PDB Entry: 2i14 (more details), 2.9 Å

PDB Description: Crystal structure of nicotinate-nucleotide pyrophosphorylase from Pyrococcus furiosus
PDB Compounds: (C:) Nicotinate-nucleotide pyrophosphorylase

SCOP Domain Sequences for d2i14c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i14c1 c.1.17.1 (C:1111-1389) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]}
qasgiataalrikiaakfkpvysfgirhmhpaiapmidraafiggcdgvsgvlgaemmge
kavgtmphaliitvgdqvkawkyfdevieeevprialvdtfydekveavmaaealgkklf
avrldtpssrrgnfrkiieevrwelkvrgydwvkifvsggldeekikeivdvvdafgvgg
aiasakpvdfaldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercpvcnak
vepllkpiiengeivvefpkareireyvleqakkfnlei

SCOP Domain Coordinates for d2i14c1:

Click to download the PDB-style file with coordinates for d2i14c1.
(The format of our PDB-style files is described here.)

Timeline for d2i14c1: