Lineage for d2i13b1 (2i13 B:31-178)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048037Fold k.12: Zinc finger design [58856] (1 superfamily)
  4. 3048038Superfamily k.12.1: Zinc finger design [58857] (1 family) (S)
  5. 3048039Family k.12.1.1: Zinc finger design [58858] (7 proteins)
  6. 3048040Protein AART, designed six-finger protein [144340] (1 species)
  7. 3048041Species Synthetic [144341] (1 PDB entry)
  8. 3048043Domain d2i13b1: 2i13 B:31-178 [136965]
    automatically matched to 2I13 A:31-184
    protein/DNA complex; complexed with gol, zn

Details for d2i13b1

PDB Entry: 2i13 (more details), 1.96 Å

PDB Description: Aart, a six finger zinc finger designed to recognize ANN triplets
PDB Compounds: (B:) Aart

SCOPe Domain Sequences for d2i13b1:

Sequence, based on SEQRES records: (download)

>d2i13b1 k.12.1.1 (B:31-178) AART, designed six-finger protein {Synthetic}
fsrsdhlaehqrthtgekpykcpecgksfsdkkdltrhqrthtgekpykcpecgksfsqr
anlrahqrthtgekpyacpecgksfsqlahlrahqrthtgekpykcpecgksfsrednlh
thqrthtgekpykcpecgksfsrrdaln

Sequence, based on observed residues (ATOM records): (download)

>d2i13b1 k.12.1.1 (B:31-178) AART, designed six-finger protein {Synthetic}
fsrsdhlaehqrthtgekpykcpecgksfsdkkdltrhqrthtgekpykcpecgksfsqr
anlrahqrthtgekpyacpecgksfsqlahlrahqrthtgekpykcpecgksfsrednlh
thqrthtrrdaln

SCOPe Domain Coordinates for d2i13b1:

Click to download the PDB-style file with coordinates for d2i13b1.
(The format of our PDB-style files is described here.)

Timeline for d2i13b1: