![]() | Class k: Designed proteins [58788] (44 folds) |
![]() | Fold k.12: Zinc finger design [58856] (1 superfamily) |
![]() | Superfamily k.12.1: Zinc finger design [58857] (1 family) ![]() |
![]() | Family k.12.1.1: Zinc finger design [58858] (7 proteins) |
![]() | Protein AART, designed six-finger protein [144340] (1 species) |
![]() | Species Synthetic [144341] (1 PDB entry) |
![]() | Domain d2i13b1: 2i13 B:31-178 [136965] automatically matched to 2I13 A:31-184 protein/DNA complex; complexed with gol, zn |
PDB Entry: 2i13 (more details), 1.96 Å
SCOPe Domain Sequences for d2i13b1:
Sequence, based on SEQRES records: (download)
>d2i13b1 k.12.1.1 (B:31-178) AART, designed six-finger protein {Synthetic} fsrsdhlaehqrthtgekpykcpecgksfsdkkdltrhqrthtgekpykcpecgksfsqr anlrahqrthtgekpyacpecgksfsqlahlrahqrthtgekpykcpecgksfsrednlh thqrthtgekpykcpecgksfsrrdaln
>d2i13b1 k.12.1.1 (B:31-178) AART, designed six-finger protein {Synthetic} fsrsdhlaehqrthtgekpykcpecgksfsdkkdltrhqrthtgekpykcpecgksfsqr anlrahqrthtgekpyacpecgksfsqlahlrahqrthtgekpykcpecgksfsrednlh thqrthtrrdaln
Timeline for d2i13b1: