Lineage for d2i10b2 (2i10 B:79-194)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923028Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 923029Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 923030Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)
  6. 923172Protein Putative transcriptional regulator RHA1_ro09068 [140879] (1 species)
  7. 923173Species Rhodococcus sp. [TaxId:1831] [140880] (1 PDB entry)
    Uniprot Q0RX74 79-194
  8. 923175Domain d2i10b2: 2i10 B:79-194 [136963]
    Other proteins in same PDB: d2i10a1, d2i10b1
    automatically matched to 2I10 A:79-194
    complexed with npo, pge

Details for d2i10b2

PDB Entry: 2i10 (more details), 2.05 Å

PDB Description: Putative TetR transcriptional regulator from Rhodococcus sp. RHA1
PDB Compounds: (B:) Putative TetR transcriptional regulator

SCOPe Domain Sequences for d2i10b2:

Sequence, based on SEQRES records: (download)

>d2i10b2 a.121.1.1 (B:79-194) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]}
ptaheavldfltgrvevftapgqpfgcmtvqaglasgephheivdlltaareqmrqtvld
rfekaladgdlpagtdctalaryvmaavyglsveaasgapreeltaaailaaqvvp

Sequence, based on observed residues (ATOM records): (download)

>d2i10b2 a.121.1.1 (B:79-194) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]}
ptaheavldfltgrvevftgqpfgcmtvqaglasphheivdlltaareqmrqtvldrfek
aladgdlpagtdctalaryvmaavyglsveaasgapreeltaaailaaqvvp

SCOPe Domain Coordinates for d2i10b2:

Click to download the PDB-style file with coordinates for d2i10b2.
(The format of our PDB-style files is described here.)

Timeline for d2i10b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i10b1