Class a: All alpha proteins [46456] (284 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins) |
Protein Putative transcriptional regulator RHA1_ro09068 [140879] (1 species) |
Species Rhodococcus sp. [TaxId:1831] [140880] (1 PDB entry) Uniprot Q0RX74 79-194 |
Domain d2i10b2: 2i10 B:79-194 [136963] Other proteins in same PDB: d2i10a1, d2i10b1 automatically matched to 2I10 A:79-194 complexed with npo, pge |
PDB Entry: 2i10 (more details), 2.05 Å
SCOPe Domain Sequences for d2i10b2:
Sequence, based on SEQRES records: (download)
>d2i10b2 a.121.1.1 (B:79-194) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]} ptaheavldfltgrvevftapgqpfgcmtvqaglasgephheivdlltaareqmrqtvld rfekaladgdlpagtdctalaryvmaavyglsveaasgapreeltaaailaaqvvp
>d2i10b2 a.121.1.1 (B:79-194) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]} ptaheavldfltgrvevftgqpfgcmtvqaglasphheivdlltaareqmrqtvldrfek aladgdlpagtdctalaryvmaavyglsveaasgapreeltaaailaaqvvp
Timeline for d2i10b2: