SCOP 1.73: Domain d2i10b2: 2i10 B:79-194

Lineage for d2i10b2 (2i10 B:79-194)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 proteins)

6. Protein Putative transcriptional regulator RHA1_ro09068 [140879] (1 species)

7. Species Rhodococcus sp. [TaxId:1831] [140880] (1 PDB entry)

8. Domain d2i10b2: 2i10 B:79-194 [136963]
   Other proteins in same PDB: d2i10a1, d2i10b1
   automatically matched to 2I10 A:79-194
   complexed with npo, pge

Details for d2i10b2

PDB Entry: 2i10, 2.05 Å

PDB Description: Putative TetR transcriptional regulator from Rhodococcus sp. RHA1

PDB Compounds: (B:) Putative TetR transcriptional regulator

SCOP Domain Sequences for d2i10b2:

Sequence, based on SEQRES records:

>d2i10b2 a.121.1.1 (B:79-194) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]}
ptaheavldfltgrvevftapgqpfgcmtvqaglasgephheivdlltaareqmrqtvld
rfekaladgdlpagtdctalaryvmaavyglsveaasgapreeltaaailaaqvvp

Sequence, based on observed residues (ATOM records):

>d2i10b2 a.121.1.1 (B:79-194) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]}
ptaheavldfltgrvevftgqpfgcmtvqaglasphheivdlltaareqmrqtvldrfek
aladgdlpagtdctalaryvmaavyglsveaasgapreeltaaailaaqvvp

Timeline for d2i10b2:

• d2i10b2 is new in SCOP 1.73
  
• d2i10b2 appears in SCOP 1.75
  
• d2i10b2 appears in the current release, SCOPe 2.08