![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (17 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (28 proteins) |
![]() | Protein Putative transcriptional regulator RHA1_ro09068 [140185] (1 species) |
![]() | Species Rhodococcus sp. [TaxId:1831] [140186] (1 PDB entry) |
![]() | Domain d2i10b1: 2i10 B:11-78 [136962] Other proteins in same PDB: d2i10a2, d2i10b2 automatically matched to 2I10 A:10-78 complexed with npo, pge |
PDB Entry: 2i10 (more details), 2.05 Å
SCOP Domain Sequences for d2i10b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i10b1 a.4.1.9 (B:11-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]} dqvalqtamelfwrqgyegtsitdltkalginppslyaafgskrdlfektldrymcertl qleeamvr
Timeline for d2i10b1: