Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Putative transcriptional regulator RHA1_ro09068 [140185] (1 species) |
Species Rhodococcus sp. [TaxId:1831] [140186] (1 PDB entry) Uniprot Q0RX74 10-78 |
Domain d2i10b1: 2i10 B:11-78 [136962] Other proteins in same PDB: d2i10a2, d2i10b2 automated match to d2i10a1 complexed with npo, pge |
PDB Entry: 2i10 (more details), 2.05 Å
SCOPe Domain Sequences for d2i10b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i10b1 a.4.1.9 (B:11-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]} dqvalqtamelfwrqgyegtsitdltkalginppslyaafgskrdlfektldrymcertl qleeamvr
Timeline for d2i10b1: