Lineage for d2i10b1 (2i10 B:11-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692418Protein Putative transcriptional regulator RHA1_ro09068 [140185] (1 species)
  7. 2692419Species Rhodococcus sp. [TaxId:1831] [140186] (1 PDB entry)
    Uniprot Q0RX74 10-78
  8. 2692421Domain d2i10b1: 2i10 B:11-78 [136962]
    Other proteins in same PDB: d2i10a2, d2i10b2
    automated match to d2i10a1
    complexed with npo, pge

Details for d2i10b1

PDB Entry: 2i10 (more details), 2.05 Å

PDB Description: Putative TetR transcriptional regulator from Rhodococcus sp. RHA1
PDB Compounds: (B:) Putative TetR transcriptional regulator

SCOPe Domain Sequences for d2i10b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i10b1 a.4.1.9 (B:11-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]}
dqvalqtamelfwrqgyegtsitdltkalginppslyaafgskrdlfektldrymcertl
qleeamvr

SCOPe Domain Coordinates for d2i10b1:

Click to download the PDB-style file with coordinates for d2i10b1.
(The format of our PDB-style files is described here.)

Timeline for d2i10b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i10b2