SCOP 1.75: Domain d2i10a1: 2i10 A:10-78

Lineage for d2i10a1 (2i10 A:10-78)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Putative transcriptional regulator RHA1_ro09068 [140185] (1 species)

7. Species Rhodococcus sp. [TaxId:1831] [140186] (1 PDB entry)
   Uniprot Q0RX74 10-78

8. Domain d2i10a1: 2i10 A:10-78 [136960]
   Other proteins in same PDB: d2i10a2, d2i10b2
   complexed with npo, pge

Details for d2i10a1

PDB Entry: 2i10, 2.05 Å

PDB Description: Putative TetR transcriptional regulator from Rhodococcus sp. RHA1

PDB Compounds: (A:) Putative TetR transcriptional regulator

SCOP Domain Sequences for d2i10a1:

Sequence; same for both SEQRES and ATOM records:

>d2i10a1 a.4.1.9 (A:10-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]}
ddqvalqtamelfwrqgyegtsitdltkalginppslyaafgskrdlfektldrymcert
lqleeamvr

Timeline for d2i10a1:

• d2i10a1 first appeared in SCOP 1.73
  
• d2i10a1 appears in SCOPe 2.01
  
• d2i10a1 appears in the current release, SCOPe 2.08