![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Core domain of telomere end binding protein beta subunit [50275] (1 species) |
![]() | Species Oxytricha nova [TaxId:200597] [50276] (14 PDB entries) |
![]() | Domain d2i0qb1: 2i0q B:9-224 [136959] Other proteins in same PDB: d2i0qa1, d2i0qa2, d2i0qa3 automatically matched to d1ph1b_ protein/DNA complex; complexed with cl, edo |
PDB Entry: 2i0q (more details), 1.91 Å
SCOPe Domain Sequences for d2i0qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i0qb1 b.40.4.3 (B:9-224) Core domain of telomere end binding protein beta subunit {Oxytricha nova [TaxId: 200597]} qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag ivkasaskgdefsdfsfkegntatlkiadifvqekg
Timeline for d2i0qb1: