SCOP 1.73: Domain d2i0qa3: 2i0q A:329-495

Lineage for d2i0qa3 (2i0q A:329-495)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
   barrel, closed; n=5, S=10

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)
   duplication: consists of three domains of this fold

7. Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries)

8. Domain d2i0qa3: 2i0q A:329-495 [136958]
   Other proteins in same PDB: d2i0qb1
   automatically matched to d1jb7a3
   complexed with cl, edo

Details for d2i0qa3

PDB Entry: 2i0q, 1.91 Å

PDB Description: Crystal structure of a telomere single-strand DNA-protein complex from O. nova with full-length alpha and beta telomere proteins

PDB Compounds: (A:) Telomere-binding protein alpha subunit

SCOP Domain Sequences for d2i0qa3:

Sequence; same for both SEQRES and ATOM records:

>d2i0qa3 b.40.4.3 (A:329-495) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
slnavvltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvk
gydrktkkssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvka
dnlhknadarkkledsaelltkfnsyvdavverrngfylikdtkliy

Timeline for d2i0qa3:

• d2i0qa3 is new in SCOP 1.73
  
• d2i0qa3 appears in SCOP 1.75
  
• d2i0qa3 appears in the current release, SCOPe 2.08