Lineage for d2i0qa3 (2i0q A:329-495)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789484Protein Telomere end binding protein alpha subunit [50273] (1 species)
    duplication: consists of three domains of this fold
  7. 2789485Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries)
  8. 2789491Domain d2i0qa3: 2i0q A:329-495 [136958]
    Other proteins in same PDB: d2i0qb1
    automatically matched to d1jb7a3
    protein/DNA complex; complexed with cl, edo

Details for d2i0qa3

PDB Entry: 2i0q (more details), 1.91 Å

PDB Description: Crystal structure of a telomere single-strand DNA-protein complex from O. nova with full-length alpha and beta telomere proteins
PDB Compounds: (A:) Telomere-binding protein alpha subunit

SCOPe Domain Sequences for d2i0qa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i0qa3 b.40.4.3 (A:329-495) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
slnavvltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvk
gydrktkkssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvka
dnlhknadarkkledsaelltkfnsyvdavverrngfylikdtkliy

SCOPe Domain Coordinates for d2i0qa3:

Click to download the PDB-style file with coordinates for d2i0qa3.
(The format of our PDB-style files is described here.)

Timeline for d2i0qa3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i0qb1