Lineage for d2i0qa2 (2i0q A:205-328)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2398969Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2399108Protein Telomere end binding protein alpha subunit [50273] (1 species)
    duplication: consists of three domains of this fold
  7. 2399109Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries)
  8. 2399114Domain d2i0qa2: 2i0q A:205-328 [136957]
    Other proteins in same PDB: d2i0qb1
    automatically matched to d1jb7a2
    protein/DNA complex; complexed with cl, edo

Details for d2i0qa2

PDB Entry: 2i0q (more details), 1.91 Å

PDB Description: Crystal structure of a telomere single-strand DNA-protein complex from O. nova with full-length alpha and beta telomere proteins
PDB Compounds: (A:) Telomere-binding protein alpha subunit

SCOPe Domain Sequences for d2i0qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i0qa2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]}
vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph
vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqddhsvevasl
kknv

SCOPe Domain Coordinates for d2i0qa2:

Click to download the PDB-style file with coordinates for d2i0qa2.
(The format of our PDB-style files is described here.)

Timeline for d2i0qa2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i0qb1