![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Telomere end binding protein alpha subunit [50273] (1 species) duplication: consists of three domains of this fold |
![]() | Species Oxytricha nova [TaxId:200597] [50274] (16 PDB entries) |
![]() | Domain d2i0qa2: 2i0q A:205-328 [136957] Other proteins in same PDB: d2i0qb1 automatically matched to d1jb7a2 protein/DNA complex; complexed with cl, edo |
PDB Entry: 2i0q (more details), 1.91 Å
SCOPe Domain Sequences for d2i0qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i0qa2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova [TaxId: 200597]} vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqddhsvevasl kknv
Timeline for d2i0qa2: