Lineage for d2i0ha_ (2i0h A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588572Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2588573Species Human (Homo sapiens) [TaxId:9606] [56130] (202 PDB entries)
  8. 2588708Domain d2i0ha_: 2i0h A: [136952]
    automated match to d1a9u__
    complexed with 222, gol

Details for d2i0ha_

PDB Entry: 2i0h (more details), 2 Å

PDB Description: the structure of p38alpha in complex with an arylpyridazinone
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d2i0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i0ha_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

SCOPe Domain Coordinates for d2i0ha_:

Click to download the PDB-style file with coordinates for d2i0ha_.
(The format of our PDB-style files is described here.)

Timeline for d2i0ha_: