SCOP 1.73: Domain d2i09b1: 2i09 B:2-107,B:227-403

Lineage for d2i09b1 (2i09 B:2-107,B:227-403)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
   core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest

4. Superfamily c.76.1: Alkaline phosphatase-like [53649] (5 families)

5. Family c.76.1.5: DeoB catalytic domain-like [142735] (1 protein)
   Pfam PF08342 in the N-terminal part; Pfam 01676 in the C-terminal part; there is an alpha+beta domain between the two parts, inserted in the same location as the substrate-binding domain of 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase

6. Protein Phosphopentomutase DeoB [142736] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [142737] (1 PDB entry)

8. Domain d2i09b1: 2i09 B:2-107,B:227-403 [136948]
   Other proteins in same PDB: d2i09a2, d2i09b2
   automatically matched to 2I09 A:2-107,A:227-403

Details for d2i09b1

PDB Entry: 2i09, 2 Å

PDB Description: Crystal structure of putative phosphopentomutase from Streptococcus mutans

PDB Compounds: (B:) Phosphopentomutase

SCOP Domain Sequences for d2i09b1:

Sequence; same for both SEQRES and ATOM records:

>d2i09b1 c.76.1.5 (B:2-107,B:227-403) Phosphopentomutase DeoB {Streptococcus mutans [TaxId: 1309]}
stfnrihlvvldsvgigaapdannfsnagvpdgasdtlghisktvglnvpnmakiglgni
prdtplktvpaenhptgyvtkleevslgkdtmtghweimglnitepXspfaptvlnklad
agvstyavgkindifngsgitndmghnksnshgvdtliktmglsaftkgfsftnlvdfda
lyghrrnahgyrdclhefderlpeiiaamkvddlllitadhgndptyagtdhtreyvpll
ayspsftgngvlpvghyadisatiadnfgvdtamigesfldkli

Timeline for d2i09b1:

• d2i09b1 is new in SCOP 1.73
  
• d2i09b1 last appears in SCOP 1.75