SCOPe 2.06: Domain d2i03d2: 2i03 D:509-764

Lineage for d2i03d2 (2i03 D:509-764)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries)

8. Domain d2i03d2: 2i03 D:509-764 [136945]
   Other proteins in same PDB: d2i03a1, d2i03b1, d2i03c1, d2i03d1
   automated match to d1tk3a2
   complexed with axd

Details for d2i03d2

PDB Entry: 2i03, 2.4 Å

PDB Description: crystal structure of human dipeptidyl peptidase 4 (dpp iv) with potent alkynyl cyanopyrrolidine (abt-279)

PDB Compounds: (D:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2i03d2:

Sequence; same for both SEQRES and ATOM records:

>d2i03d2 c.69.1.0 (D:509-764) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

Timeline for d2i03d2:

• d2i03d2 first appeared in SCOP 1.73
  
• d2i03d2 appears in SCOPe 2.05
  
• d2i03d2 appears in SCOPe 2.07
  
• d2i03d2 appears in the current release, SCOPe 2.08