Lineage for d2i03b2 (2i03 B:509-764)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871215Species Human (Homo sapiens) [TaxId:9606] [188340] (51 PDB entries)
  8. 1871253Domain d2i03b2: 2i03 B:509-764 [136941]
    Other proteins in same PDB: d2i03a1, d2i03b1, d2i03c1, d2i03d1
    automated match to d1tk3a2
    complexed with axd

Details for d2i03b2

PDB Entry: 2i03 (more details), 2.4 Å

PDB Description: crystal structure of human dipeptidyl peptidase 4 (dpp iv) with potent alkynyl cyanopyrrolidine (abt-279)
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2i03b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i03b2 c.69.1.0 (B:509-764) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

SCOPe Domain Coordinates for d2i03b2:

Click to download the PDB-style file with coordinates for d2i03b2.
(The format of our PDB-style files is described here.)

Timeline for d2i03b2: