Lineage for d2i03b1 (2i03 B:39-508)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 807891Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 807975Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
  5. 807976Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
    Pfam PF00930
  6. 807983Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 808058Species Pig (Sus scrofa) [TaxId:9823] [89381] (28 PDB entries)
  8. 808098Domain d2i03b1: 2i03 B:39-508 [136940]
    Other proteins in same PDB: d2i03a2, d2i03b2, d2i03c2, d2i03d2
    automatically matched to d1orva1
    complexed with axd

Details for d2i03b1

PDB Entry: 2i03 (more details), 2.4 Å

PDB Description: crystal structure of human dipeptidyl peptidase 4 (dpp iv) with potent alkynyl cyanopyrrolidine (abt-279)
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOP Domain Sequences for d2i03b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i03b1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOP Domain Coordinates for d2i03b1:

Click to download the PDB-style file with coordinates for d2i03b1.
(The format of our PDB-style files is described here.)

Timeline for d2i03b1: