Lineage for d2i03a1 (2i03 A:39-508)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399926Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2400039Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2400040Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 protein domains)
    Pfam PF00930
  6. 2400047Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2400048Species Human (Homo sapiens) [TaxId:9606] [82174] (94 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2400199Domain d2i03a1: 2i03 A:39-508 [136938]
    Other proteins in same PDB: d2i03a2, d2i03b2, d2i03c2, d2i03d2
    automated match to d2bgra1
    complexed with axd

Details for d2i03a1

PDB Entry: 2i03 (more details), 2.4 Å

PDB Description: crystal structure of human dipeptidyl peptidase 4 (dpp iv) with potent alkynyl cyanopyrrolidine (abt-279)
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2i03a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i03a1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d2i03a1:

Click to download the PDB-style file with coordinates for d2i03a1.
(The format of our PDB-style files is described here.)

Timeline for d2i03a1: