Lineage for d2i02b_ (2i02 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792693Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1792694Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1792695Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 1792727Protein General stress protein 26 [141352] (1 species)
  7. 1792728Species Nostoc punctiforme pcc 73102 [TaxId:63737] [141353] (1 PDB entry)
  8. 1792730Domain d2i02b_: 2i02 B: [136937]
    automated match to d2i02a1
    complexed with cl, fmn, p33

Details for d2i02b_

PDB Entry: 2i02 (more details), 1.8 Å

PDB Description: crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution
PDB Compounds: (B:) general stress protein of COG3871

SCOPe Domain Sequences for d2i02b_:

Sequence, based on SEQRES records: (download)

>d2i02b_ b.45.1.1 (B:) General stress protein 26 {Nostoc punctiforme pcc 73102 [TaxId: 63737]}
tdrtqeiqklheliknidygmfttvdddgslhsypmsksgdinseatlwfftyagshkvt
eiehheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldepdiall
kvninqvnywdstssfkpqtisf

Sequence, based on observed residues (ATOM records): (download)

>d2i02b_ b.45.1.1 (B:) General stress protein 26 {Nostoc punctiforme pcc 73102 [TaxId: 63737]}
tdrtqeiqklheliknidygmfttvdddgslhsypmsksgdinseatlwfftyagshkvt
eiehheqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldepdiall
kvninqvnywdsfkpqtisf

SCOPe Domain Coordinates for d2i02b_:

Click to download the PDB-style file with coordinates for d2i02b_.
(The format of our PDB-style files is described here.)

Timeline for d2i02b_: